PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA10G00451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 363aa    MW: 41467.4 Da    PI: 6.0778
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA10G00451genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding414.3e-131966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ede lv +v++ G g+W+++ ++  + R++k+c++rw ++l
       AA10G00451 19 KGPWTEAEDEMLVAYVRENGEGNWNAVKNKTWLVRCGKSCRLRWTNHL 66
                     79******************************99***********996 PP

2Myb_DNA-binding51.13.2e-1672115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T eE+ l++++++qlG++ W++ a+ ++ gRt++++k++w++
       AA10G00451  72 KGSFTLEEERLIIQLHAQLGNK-WARMAAQLP-GRTDNEIKNYWNT 115
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4271466IPR017930Myb domain
SuperFamilySSF466891.05E-2817113IPR009057Homeodomain-like
SMARTSM007177.9E-111868IPR001005SANT/Myb domain
PfamPF002491.7E-111966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-202073IPR009057Homeodomain-like
CDDcd001673.15E-92166No hitNo description
PROSITE profilePS5129425.19167121IPR017930Myb domain
SMARTSM007171.5E-1571119IPR001005SANT/Myb domain
PfamPF002497.3E-1572115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-2574119IPR009057Homeodomain-like
CDDcd001675.49E-1174117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MILYGAGAAK DGSTMVLKKG PWTEAEDEML VAYVRENGEG NWNAVKNKTW LVRCGKSCRL  60
RWTNHLRPNL RKGSFTLEEE RLIIQLHAQL GNKWARMAAQ LPGRTDNEIK NYWNTRLKKL  120
QRQGLPLYPL DIISNNHQNL PSSSSSFTFP VQLKRDQTPL NSTVSTSSGF TPLFKESSSC  180
PNFLQTNFSP SFYQSINPVY SFKPELPSNQ TQCFTVYERY NQSLNTGLQT STSCQLLEDL  240
MKETESLAGG YRGSKRRKVM SLPEEHNEDD DKFFSGKSPV FTNLRSKEED DILKLLDWGN  300
ESGEISNEQS PEDNFVLDDH NFSFLFPVVA TENTMTQDED KNNTDNNLFV SCPWDNLPKI  360
NQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-28161191103C-Myb DNA-Binding Domain
1msf_C2e-28161191103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1984997e-32AF198499.1 Nicotiana tabacum anther-specific myb-related protein 1 (mybAS1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413125.11e-127hypothetical protein EUTSA_v10025350mg
TrEMBLV4MNQ31e-127V4MNQ3_EUTSA; Uncharacterized protein
STRINGAT4G26930.11e-121(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99391934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26930.11e-124myb domain protein 97